PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g23110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 453aa    MW: 50948.1 Da    PI: 5.6435
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g23110genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox45.31.5e-149471856
                HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                 F+++++p++++r +L++ lgL  rq+k+WFqNrR+++k
  CA03g23110  9 IFKECPHPDEKTRLQLSRDLGLAPRQIKFWFQNRRTQMK 47
                6***********************************998 PP

2START180.31.1e-561904182206
                 HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEE CS
       START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevi 85 
                 +a  a++el+++++ +ep+W+kss     + +n d + q f+++++       ++ea+r+sgvv+m+   lv  ++d + +W+e ++    ka tlevi
  CA03g23110 190 VAGNAMEELIRLVQTNEPLWMKSSsidgrDVLNFDNYDQVFPRTNShlknpnVRIEASRDSGVVIMNGLALVDVFMDAN-KWQEFFPtivsKARTLEVI 287
                 67899*******************99999899999999999998889999999**************************.******************* PP

                 CTT.......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE.EEEE-EE--SS CS
       START  86 ssg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv.twvehvdlkgr 175
                 ssg       ++lqlm+ elq+lsplvp R f+f+R+++q ++g+w+ivdvS d  q+++ ss + ++++lpSg+li +++ng+skv twvehv+++++
  CA03g23110 288 SSGvmgsrtsSTLQLMYEELQVLSPLVPtRQFYFLRFCQQIEQGSWAIVDVSYDIAQENQYSSTSCKVHRLPSGCLILDMPNGYSKVvTWVEHVEVEEK 386
                 ***********************************************************99************************9648*******987 PP

                 XX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
       START 176 lp.hwllrslvksglaegaktwvatlqrqcek 206
                    h l+r l++sgla+ga +wv tlqr ce+
  CA03g23110 387 GLiHRLYRDLIHSGLAFGAERWVGTLQRVCER 418
                 555***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.6E-8153IPR001356Homeobox domain
CDDcd000861.54E-12850No hitNo description
SuperFamilySSF466899.19E-13952IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-14954IPR009057Homeodomain-like
PfamPF000463.9E-12947IPR001356Homeobox domain
PROSITE profilePS5007113.751049IPR001356Homeobox domain
PROSITE patternPS0002702447IPR017970Homeobox, conserved site
PROSITE profilePS5084846.73180421IPR002913START domain
SuperFamilySSF559611.24E-33181420No hitNo description
CDDcd088751.38E-115184417No hitNo description
SMARTSM002344.6E-48189418IPR002913START domain
PfamPF018521.2E-48190418IPR002913START domain
Gene3DG3DSA:3.30.530.205.9E-4258403IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MFVFGVCSIF KECPHPDEKT RLQLSRDLGL APRQIKFWFQ NRRTQMKAQH ERADNCALRT  60
ENDKIRCENI AIREALKNVI CPSCGGPPVN EDSYFDEQKL RIENMQLKEE LDKVSSIAAK  120
YIGRPISQLP PVQPIHLSSL DLSMSSFIGH GPSSLDLDLD LLPGSSSAMP SLAYATLNLS  180
DMDKSLMADV AGNAMEELIR LVQTNEPLWM KSSSIDGRDV LNFDNYDQVF PRTNSHLKNP  240
NVRIEASRDS GVVIMNGLAL VDVFMDANKW QEFFPTIVSK ARTLEVISSG VMGSRTSSTL  300
QLMYEELQVL SPLVPTRQFY FLRFCQQIEQ GSWAIVDVSY DIAQENQYSS TSCKVHRLPS  360
GCLILDMPNG YSKVVTWVEH VEVEEKGLIH RLYRDLIHSG LAFGAERWVG TLQRVCERYA  420
CLMVNSNPSH DLGGGNLNQD WFVFPSITGN LN*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-163HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563952.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLK4BJN50.0K4BJN5_SOLLC; Uncharacterized protein
STRINGSolyc03g098200.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24902351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-180homeodomain GLABROUS 11